DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-IV and SIGLEC14

DIOPT Version :9

Sequence 1:NP_001034052.2 Gene:side-IV / 41657 FlyBaseID:FBgn0038156 Length:1001 Species:Drosophila melanogaster
Sequence 2:NP_001092082.1 Gene:SIGLEC14 / 100049587 HGNCID:32926 Length:396 Species:Homo sapiens


Alignment Length:492 Identity:107/492 - (21%)
Similarity:160/492 - (32%) Gaps:180/492 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLLPLLMLSGISQVCSTYVEQDELMQNLDRPVPLTTVQGVLGRQAMLPCDISPQER----DDAVY 105
            ||||||....:         |::.:..|.....:|..:|:.   .::||..|...|    ...:|
Human     5 LLLPLLWGGSL---------QEKPVYELQVQKSVTVQEGLC---VLVPCSFSYPWRSWYSSPPLY 57

  Fly   106 MVLWFREGDGEPIY-------NFDVRGRQFGQARLWSSPTAFGTRAHFSSTTHPAQLKIDNIRIE 163
             |.|||:|: .|.|       |.|.|.:...|.|.         |...........|.|.:.|:|
Human    58 -VYWFRDGE-IPYYAEVVATNNPDRRVKPETQGRF---------RLLGDVQKKNCSLSIGDARME 111

  Fly   164 DEGVYRCRV----DFRNSPTRNLKINLTVIVPPDRPVIYGQNRHEKAGNVESFSEGNDIVLSCEV 224
            |.|.|..||    |.:.|..:| |:||.|....::|.|:         .:|....|....|||.:
Human   112 DTGSYFFRVERGRDVKYSYQQN-KLNLEVTALIEKPDIH---------FLEPLESGRPTRLSCSL 166

  Fly   225 SGGRPRPNVTWYLDNTAIDESFEQRPDGKTINHLSYPNVGRQHLNSRLMCVASNTNLTPPNNRVV 289
            .|                                                               
Human   167 PG--------------------------------------------------------------- 168

  Fly   290 ILDVNLKPIAVHILTKDRFVSADRTYDVECKSSGSKPPALITWWKGSKQLKKLTKNFNEPDNQSL 354
                                        .|::.   ||...:|  ....|..|     :|:....
Human   169 ----------------------------SCEAG---PPLTFSW--TGNALSPL-----DPETTRS 195

  Fly   355 SILTFTPGREDDGKYLTCRAENQFIDGSAI--EDKWRLIVHYQPT-------------TTLKIGS 404
            |.||.||..||.|..|||:.:.|   |:.:  |...:|.|.|.|.             |.|:|.|
Human   196 SELTLTPRPEDHGTNLTCQVKRQ---GAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILS 257

  Fly   405 SLNPDDIKEGDDAYFECIVLANPKPYKMSWFHNGKEL---QHNISAGVILSDQSLVLQSVSRASA 466
            :.....|:||...:..|.|.:|| |..:|||..||.|   |.::|.       :|.|.::.....
Human   258 NGMSVPIQEGQSLFLACTVDSNP-PASLSWFREGKALNPSQTSMSG-------TLELPNIGAREG 314

  Fly   467 GDYTCLAVNSEGKGPSNPV--TLRIRYAPICATDHEE 501
            |::||...:..|....:.:  ..|...:.||.|:.::
Human   315 GEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IVNP_001034052.2 V-set 79..188 CDD:284989 35/123 (28%)
IG_like 80..188 CDD:214653 34/122 (28%)
Ig 210..281 CDD:299845 6/70 (9%)
Ig 319..392 CDD:299845 22/74 (30%)
IG_like 319..383 CDD:214653 20/63 (32%)
IG_like 412..489 CDD:214653 21/81 (26%)
IGc2 413..478 CDD:197706 20/67 (30%)
Ig_3 509..572 CDD:290638
fn3 593..675 CDD:278470
SIGLEC14NP_001092082.1 Ig_Siglec_N 21..140 CDD:143189 36/133 (27%)
IG_like 26..139 CDD:214653 35/127 (28%)
Ig 150..216 CDD:299845 24/166 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..209 8/18 (44%)
Ig 252..335 CDD:299845 25/90 (28%)
IG_like 261..336 CDD:214653 22/82 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.