DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yrt and FRMD5

DIOPT Version :9

Sequence 1:NP_650291.1 Gene:yrt / 41656 FlyBaseID:FBgn0004049 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_116281.2 Gene:FRMD5 / 84978 HGNCID:28214 Length:570 Species:Homo sapiens


Alignment Length:498 Identity:159/498 - (31%)
Similarity:259/498 - (52%) Gaps:59/498 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITSGGSSQIKPQRIVVNKNKIDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQ 102
            :.||.|..:        :.:..|.|.|||:::.:..:.:.|.|.:|::.:.:.|:::||||||::
Human     5 LMSGSSRSL--------EREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIR 61

  Fly   103 FMDANHVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRL 167
            |:|.:..:|||:.||.:.||::..||:|...:||||.::|..|:||:||||.|||:|:||..|||
Human    62 FVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRL 126

  Fly   168 DCPEDKATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKT-CRGLTPAQA 231
            .|....|..|.|..||:|:||||:.:|.....|:|:|.|:.:|.||..|.:.:|| ..|.|||.:
Human   127 LCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATS 191

  Fly   232 ETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKL 296
            |..||.||:.|:.||||.|......|....|..||.|.:|.:.::::....|.:::||.|:.|..
Human   192 ELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTF 256

  Fly   297 TLIVIEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR--APVKGPSARQNFFRMGSR 359
            .|.|.:.:    |::....:.....:||||||||.:|:..|::|.  :.|:..|:...||: |||
Human   257 YLYVSQKE----EKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFK-GSR 316

  Fly   360 FRYSGRTEFQTTQQSR--ARRTVQFERR--------PSQRFASRQSHLLRERQKASQEAAVSAVA 414
            ||||||...:..:.|.  .|...:..|.        ||.....|.|.:.|.|::|...:.:..:.
Human   317 FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLE 381

  Fly   415 SVNARAAAAAAAAAASQSPAPATPLVS-SQVSTPTPN-----NDNNNDAFDSLISTDQFITVTPS 473
            |:              :..|.:||:.| |...|..|:     .|:|...  ::|:.:.:   :|:
Human   382 SL--------------RDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERV--AVIADEAY---SPA 427

  Fly   474 PSVL--TVIQNSAIIE------PDAACSGSISSSSQAAANFAS 508
            .|||  .|.::|..:.      ..|.||......|:|:...|:
Human   428 DSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTAT 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yrtNP_650291.1 B41 60..250 CDD:214604 84/190 (44%)
FERM_N 62..124 CDD:286467 23/61 (38%)
FERM_M 143..250 CDD:278785 52/107 (49%)
FERM_C_NBL4_NBL5 246..339 CDD:270007 28/92 (30%)
FA 352..392 CDD:285894 16/49 (33%)
PHA03255 771..>924 CDD:165513
FRMD5NP_116281.2 B41 19..210 CDD:214604 84/190 (44%)
FERM_C_FRMD3_FRMD5 191..295 CDD:270013 35/107 (33%)
Interaction with ROCK1. /evidence=ECO:0000269|PubMed:25448675 308..353 14/45 (31%)
FA 309..354 CDD:370090 14/45 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..367 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..407 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.