DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yrt and 2310002L09Rik

DIOPT Version :9

Sequence 1:NP_650291.1 Gene:yrt / 41656 FlyBaseID:FBgn0004049 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_082257.1 Gene:2310002L09Rik / 71886 MGIID:1916780 Length:217 Species:Mus musculus


Alignment Length:106 Identity:25/106 - (23%)
Similarity:41/106 - (38%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 EAAVSAVASVNARAAAAAAAAAASQSPAPATPLVSSQVS-------TPTPNNDNNND-AFD---- 459
            :|:...|||...:.|.:|.:....:......||:.|:::       .||..:|:..| .||    
Mouse    50 DASEHMVASSPVKGAQSAGSPRKEEDKVKEDPLILSELAYNTSASLLPTQVDDDEVDMLFDCPSR 114

  Fly   460 ---SLISTDQFITVTPSPSVLTVIQNSAIIEPDAACSGSIS 497
               ....||.|..|....:|..:.:...:.|...|.|.|.|
Mouse   115 FVLEREDTDTFEDVEADENVFLMAEEEKVKEAHQALSWSYS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yrtNP_650291.1 B41 60..250 CDD:214604
FERM_N 62..124 CDD:286467
FERM_M 143..250 CDD:278785
FERM_C_NBL4_NBL5 246..339 CDD:270007
FA 352..392 CDD:285894
PHA03255 771..>924 CDD:165513
2310002L09RikNP_082257.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.