DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yrt and CG5022

DIOPT Version :9

Sequence 1:NP_650291.1 Gene:yrt / 41656 FlyBaseID:FBgn0004049 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster


Alignment Length:648 Identity:178/648 - (27%)
Similarity:259/648 - (39%) Gaps:172/648 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CRVILLDNTD-LSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIKKQV 123
            |.|.|||::| |..|......|.:|.|.:...|:|.|||||||:::|::..:||||.:|.|.||.
  Fly    14 CTVRLLDDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVDSSKQRHWLDLSKSIIKQC 78

  Fly   124 KIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCALALQSELGD 188
            |...|..|.|:||||.::|..|... .|.:.:.|||:||..|||.|...:|..|.||.:|.||||
  Fly    79 KEMDPLLFSLRVKFYPADPFRLTGN-ARIMLYQQLKRDLRHGRLYCSLGEAAALGALIVQEELGD 142

  Fly   189 YDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCR-GLTPAQAETAFLNKAKWLDMYGVDMHTV 252
            |:...|..:.||.......|||.||..|::.:|... |...:.|...||..|:.|:.||:|.|.|
  Fly   143 YNEDVHVGSYVSSIELALRQTECLEKKIIELHKKREPGQNLSLAMDEFLGIARGLETYGIDPHPV 207

  Fly   253 LGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVIEDDDEGREQEHTFVFR 317
            ....|.:.::|:..|||..|...::...|.|.:|.|::|:.|.....:...|.....::||..|:
  Fly   208 KDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEGKMFIAHLSYTDASREPKKHTVGFK 272

  Fly   318 LYNEKACKHLWKCAVEHHTFFRL-----RAPVKGPSARQNFFRMGSRFRYSGRTEFQTTQQSRAR 377
            .....||::||:||:|...||.|     .|.:.|    ..||..|::|||:||||          
  Fly   273 CPTGAACRYLWRCAIEQMLFFTLPNSQSAAVISG----GGFFSWGTKFRYTGRTE---------- 323

  Fly   378 RTVQFERRPSQRFASRQSHLLRERQKASQEAAVSAVASVNARAAAAAAAAAASQSPAPATPLVSS 442
                      :...:...:.|||::..|..:...|                   |..||||    
  Fly   324 ----------REILTENINALREQKNNSNSSKRKA-------------------SSVPATP---- 355

  Fly   443 QVSTPTPNNDNNNDAFDSLISTDQFITVTPSPSVLTVIQNSAIIEP------------------D 489
                .:|..|.....:.||                   ..|.:.||                  |
  Fly   356 ----SSPQGDLAQIRYSSL-------------------PRSTMSEPLGYGMPNGHFYGHDHGMSD 397

  Fly   490 AACSGSIS-SSSQAAANFASLGRNSLKSNFSNEDPAYSKIGSI---------GKASGLTVKLDPD 544
            |  :|.|. ||.:.....|.|    ..||....:...|:||..         ...|||||     
  Fly   398 A--NGGIQISSLEPVCEEARL----RSSNIDGVNYLASQIGGYAYRDSVEHSSTESGLTV----- 451

  Fly   545 YTPPYSPNATKNFDETNPFRNATSSHHGSFGKASISSGQLSVKSGLSDKDRELDSLLKSIVKDPS 609
                      ..:|  :|.::..:..|||: ..::..||   ..|..:.....||.|.:   |||
  Fly   452 ----------NGYD--HPRKHNEARQHGSY-SPNLYYGQ---SDGAVNSSSPADSFLHA---DPS 497

  Fly   610 -----------------PSV------LANEAINDANSIRVTINKTFDMDHNTETLKRLSNANE 649
                             |||      :|..|:             |.|:..:|..::|.|:.|
  Fly   498 TRKVKKFRKFHLLHAFVPSVIFVAFAMAGTAV-------------FIMESESEAFEQLRNSPE 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yrtNP_650291.1 B41 60..250 CDD:214604 78/191 (41%)
FERM_N 62..124 CDD:286467 28/62 (45%)
FERM_M 143..250 CDD:278785 40/107 (37%)
FERM_C_NBL4_NBL5 246..339 CDD:270007 28/92 (30%)
FA 352..392 CDD:285894 10/39 (26%)
PHA03255 771..>924 CDD:165513
CG5022NP_609384.1 B41 13..205 CDD:214604 78/191 (41%)
FERM_N 16..80 CDD:286467 28/63 (44%)
FERM_M 108..205 CDD:278785 38/96 (40%)
FERM_C_FRMD3_FRMD5 186..294 CDD:270013 34/107 (32%)
FA 308..349 CDD:285894 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39990at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23280
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.