DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yrt and CG12075

DIOPT Version :9

Sequence 1:NP_650291.1 Gene:yrt / 41656 FlyBaseID:FBgn0004049 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_001245582.1 Gene:CG12075 / 31815 FlyBaseID:FBgn0030065 Length:1006 Species:Drosophila melanogaster


Alignment Length:417 Identity:74/417 - (17%)
Similarity:118/417 - (28%) Gaps:153/417 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 PNATKNFDETN---------PFRNATSSHHGSFGKASISSG-----------QLSVKSGLSDKDR 595
            |:..|.|:|..         |...:....|.|.||:|.|.|           |.....|..:..|
  Fly   129 PDNQKRFEELETRLGILPPIPMNGSNEKRHESNGKSSSSGGTGPGSHHHHQLQSQTSGGYREGRR 193

  Fly   596 ELDSLLKSIVKDPSPSVLANEAINDANSIRVTINKTFDMDHNTETLKRLSNANEKPNNQVKLANV 660
                                                    |.|.:.||.|               
  Fly   194 ----------------------------------------HETSSPKRFS--------------- 203

  Fly   661 NTTALPPGNIKCNILKARVEEELG--AGGNAKLTNQMFVPAAHSSNMHTSNTNSSNNHAHSDGPD 723
            ::.....||   :..::...||.|  |||::.::..   |...:|..|.        |||...|.
  Fly   204 SSLGSDTGN---STRESECSEEHGLVAGGSSPVSRS---PPHGNSKSHP--------HAHPHHPP 254

  Fly   724 SLNATYISVGGDKLTLSIPEQKPSTGSSSSSSTSSTATTTTNGNGPYSNATFVSGFSAP-LTPPS 787
            .             :|..|...|...|....|.::......|||||            | |.||.
  Fly   255 H-------------SLHHPPLTPQQNSDLFDSLAAELRAKLNGNGP------------PLLLPPR 294

  Fly   788 SLPANLNNTGSGCNTTLTSVTTISTPSSPTATVSTTASESVAPALSNASAAEILINEIFINNIIN 852
            .......:.|        ::|.|.......|.:...:.:|..|.::|.:.....           
  Fly   295 DYDTVHRSKG--------NLTAIELRRCRNALIVGGSPKSQVPGVANVAGGAAA----------- 340

  Fly   853 NNASGSITAETAAKPAGSS-TPSAGTLLFSTLSEQERLESQKTNQQMNQSLNLNQNHSEVDAPPS 916
             ||:|...:...:...||. .||         .|::.|.|...::..:.    ..::|.:...||
  Fly   341 -NANGKQVSSRGSSGIGSDLAPS---------PERQELNSSSDDEHWSN----EADNSVIALKPS 391

  Fly   917 EKKTP--SNYPDSSRIPFPSSSNSKDM 941
            :...|  :.....|.:..|..|..:|:
  Fly   392 QIALPHHAQLKRKSAVQPPEDSYLRDL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yrtNP_650291.1 B41 60..250 CDD:214604
FERM_N 62..124 CDD:286467
FERM_M 143..250 CDD:278785
FERM_C_NBL4_NBL5 246..339 CDD:270007
FA 352..392 CDD:285894
PHA03255 771..>924 CDD:165513 25/156 (16%)
CG12075NP_001245582.1 PTB 12..120 CDD:269911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.