DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yrt and FRMD3

DIOPT Version :9

Sequence 1:NP_650291.1 Gene:yrt / 41656 FlyBaseID:FBgn0004049 Length:972 Species:Drosophila melanogaster
Sequence 2:NP_777598.3 Gene:FRMD3 / 257019 HGNCID:24125 Length:597 Species:Homo sapiens


Alignment Length:509 Identity:161/509 - (31%)
Similarity:240/509 - (47%) Gaps:75/509 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSQIKPQRIVVNKNKIDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDAN 107
            ||.:|..     ..::.|.:.|||::::|..:.::..|.||.:.:.....::||||||::::|..
Human    22 SSSVKSL-----SQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPE 81

  Fly   108 HVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPED 172
            ..:|||:|.|.|.||:|..||||...:||||..||..::|||||||.:||:|:|:..|||.|...
Human    82 KQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFS 146

  Fly   173 KATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKT-CRGLTPAQAETAFL 236
            .|..|.|..:|:||||||..||....:|||...|:|::.||..|::.:|. .||.:|..||...|
Human   147 DAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLL 211

  Fly   237 NKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVI 301
            .||..|:.||||.|......|....||.|..|.:||:.:::|.|..||.:.||.|:.|...:|..
Human   212 LKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGT 276

  Fly   302 EDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRL--RAPVKGPSARQNFFRMGSRFRYSG 364
            :     :|::....|......||||||||.||:..|::.  .:.:|..|:.:.||: ||||||||
Human   277 Q-----KEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFK-GSRFRYSG 335

  Fly   365 RTEFQTTQQSRARRTVQFERRPSQRF-----ASRQSHLLRER-------------QKASQEAAVS 411
            :...:..:.|.     :.:|.|.:..     .||.||.|.::             ..:.||..:.
Human   336 KVAKEVVEASS-----KIQREPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELP 395

  Fly   412 AVASVNARAAAAAAAAAASQSPAPAT-----------------PLVSSQV-------STPTPNND 452
            ....|........:|...|.||..|.                 ||..|::       ..|||.:|
Human   396 LGEGVPLPKEENISAPLISSSPVKAAREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDD 460

  Fly   453 NNNDAFDSLI-----------STDQFITVTPSPSVLTVIQNSAIIEPDAACSGS 495
               |..|.|.           .||.|..:....:...:.:...:.|...|.|.|
Human   461 ---DEIDMLFDCPSRLELEREDTDSFEDLEADENAFLIAEEEELKEARRALSWS 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yrtNP_650291.1 B41 60..250 CDD:214604 83/190 (44%)
FERM_N 62..124 CDD:286467 22/61 (36%)
FERM_M 143..250 CDD:278785 49/107 (46%)
FERM_C_NBL4_NBL5 246..339 CDD:270007 33/92 (36%)
FA 352..392 CDD:285894 13/44 (30%)
PHA03255 771..>924 CDD:165513
FRMD3NP_777598.3 B41 33..225 CDD:214604 83/191 (43%)
FERM_N 36..98 CDD:286467 22/61 (36%)
FERM_M 117..225 CDD:278785 49/107 (46%)
PH-like 206..309 CDD:302622 40/107 (37%)
FA 323..>357 CDD:285894 13/39 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..403 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151653
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.