DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and grid1a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:XP_021323097.1 Gene:grid1a / 793756 ZFINID:ZDB-GENE-120411-28 Length:1044 Species:Danio rerio


Alignment Length:405 Identity:84/405 - (20%)
Similarity:145/405 - (35%) Gaps:74/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 KLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPY 472
            |:.|.:|||.| :|:..:.|.:..|..:.   :..:||....::.:..|...|.....|..|..|
Zfish   477 KILGFKYEMYQ-VADAKYGSPQTNGSWNG---MIGELIGKRADVAISAITITPERENVVDFSKRY 537

  Fly   473 HQDELTWCVARAKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNG-YFPT 536
            ....:...:.:.:.|...|:.:|.|:......|...:....::|:|.:||...:.:|..| :.|.
Zfish   538 LDYSVGILMTKTEERLNIFSLLAPFDLAVWACIAAAIPVVGVMVFLLRRVQSVRSQNPPGPHQPA 602

  Fly   537 CLR---------VLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQ 592
            .:.         |.|..:.|...:....:.||......:|......::|.:.|.:.||..|....
Zfish   603 SVTTSFQSAIWIVYGAFVQQGGESFMSSMALRIAMGSWWLFTLIVCSSYTANLAAYLTVSRMDNA 667

  Fly   593 IHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREK----FQMCYNLVDCLNDAAQNEHIAVAV 653
            |.|.|::........||.       ::..:|:|.|.|    .:......:......:|:      
Zfish   668 IRTFQDLSKQSEINYGTV-------RESAVFEYFRVKGTNPLEQDSTFAELWRTINKNQ------ 719

  Fly   654 SRQHSFYNP-----RIQRDRLYCF--DRRESLYVYLV----TMLL------PKKYHLLHQ----- 696
            .:.:|..:|     :::||. |.|  |.....|..|.    |:::      .|.|.|..|     
Zfish   720 GQDNSVTSPAEGIRKVKRDP-YAFLWDMAVLEYAALTDDDCTLVVTGNGMSSKGYGLALQHGSPY 783

  Fly   697 ---INPVIQHIIESGHM----QKW-----ARDLDMRRMIHEEITRVREDPFKALTFDQFRGAIAF 749
               .:..|..:.|.|.:    |||     ..|||.    |.|    .:...:||....|.|....
Zfish   784 RDLFSQKILDLQEKGDLDILKQKWWPRKGRCDLDK----HAE----PQTEGRALRLHSFAGVFCI 840

  Fly   750 SGGLLLVASCVFAFE 764
            ....||:|..|.|.|
Zfish   841 LAAGLLLACLVAALE 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 16/66 (24%)
grid1aXP_021323097.1 Periplasmic_Binding_Protein_Type_1 25..424 CDD:324556
PBP2_iGluR_delta_1 437..809 CDD:270448 69/349 (20%)
DNA_pol3_gamma3 <915..1044 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.