DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir94h

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster


Alignment Length:481 Identity:90/481 - (18%)
Similarity:167/481 - (34%) Gaps:141/481 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYN-DTSPNYGESDDESYADPGEDGDGAIPDT 399
            |:.|.|   |.||.|..:.        |||    |. ...|:....:..||.|            
  Fly   163 LSGSLR---PKIFINQLKD--------LQG----YKIRVQPDLSPPNSFSYRD------------ 200

  Fly   400 ETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQ 464
               ..|:.::.|..:.:|:..::.|      :|:...||..:.:......|.::.......|...
  Fly   201 ---RHGECQVGGFLWRIVENFSKSL------KGDTQVLYPTWAKAKVSAAEYMIQFTRNGSSDIG 256

  Fly   465 FVSSSIPYHQDE-----------LTWC----VARAKRRHGFFNFVATFNADAGFLIGIFVVTCSL 514
            ..::.|.:..:|           ::||    |.:.......|:.|.: ...|..||..|::...:
  Fly   257 VTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEILFSHVLS-PGSALLLILAFILFFLI 320

  Fly   515 VVWLAQRVSGFQLRNLNGYFPTCLRVLGI-----LLNQAIPAQDFPITLRQLFALSFLMGFFFSN 574
            |                   |..::.|||     |:..|          .::|||..|.    |:
  Fly   321 V-------------------PQLIKCLGITFRGRLIGMA----------SRIFALVMLC----SS 352

  Fly   575 TYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDC 639
            :.|  |:|.|.:|....:|.:..::.::.:.:.|....:..|  ||.    .|.|:...::|.:.
  Fly   353 SAQ--LLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFL--DGG----FRAKYASAFHLTEN 409

  Fly   640 LNDAAQNEHI--------------AVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKK 690
            .|:...|.:.              .|..::|..|.:|..:.....||. .|:.:..|:.   |:.
  Fly   410 PNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDLCFS-SETPWGLLIA---PES 470

  Fly   691 YHLLHQINPVIQH----IIESGHMQKWARDLDMRRMIHEEITR--------VREDPFKALTFDQF 743
            ::     ...:||    |.::|.:.:|     |.:..||.:..        .|.:..|.|.....
  Fly   471 FY-----REPLQHFTLKINQAGLITQW-----MTQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDL 525

  Fly   744 RGA-IAFSGGLLLVASCVFAFELCYV 768
            |.. :.|:.| |..::.||..||..:
  Fly   526 RKCWVIFAVG-LGTSTVVFTIELLLI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 9/66 (14%)
Ir94hNP_651148.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.