DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir94g

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster


Alignment Length:531 Identity:99/531 - (18%)
Similarity:179/531 - (33%) Gaps:152/531 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 DDDE------LENDLSSNSSEPEAIIEEFFRAKFEDKFPRDLSGCPLT---ASFRPWEPYIFRNS 351
            |.||      |:..||.:.....||.::|                |.|   :||..:..:...|.
  Fly   106 DRDEFLVSEVLQFCLSQDMINVNAIFDDF----------------PETENLSSFEAYPSFEVVNQ 154

  Fly   352 EEQP---VDDYY----YGLQGDEDDYNDTSPNYGESDDESYADPGEDGDGAIPDTETQSGGKLKL 409
            ...|   |.|.|    ..|:|   ....|.|:|.|.:...|.|              :.|.| ::
  Fly   155 TFTPDTQVSDLYPNKMLNLRG---GVIRTMPDYSEPNTILYQD--------------KEGNK-EI 201

  Fly   410 SGIEYEMVQTIAERLHVSIEMQGENSNLYHL-FQQLIDGEIEMIVG-GIDEDP----SISQFVSS 468
            .|..:::::..|.:.:..:::..:.::...| |.:|:|.....|:. |....|    |:|:....
  Fly   202 LGYLWDLLEAYAHKHNAQLQVVNKYADDRPLNFIELLDAAQSGIIDVGASIQPMSMGSLSRMHEM 266

  Fly   469 SIPYHQDELTWCVARAKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGY 533
            |.|.:|  .:||......|....:.:.|      .:|....:...|::|:...|       |.|.
  Fly   267 SYPVNQ--ASWCTMLPVERQLHVSELLT------RVIPYPTLALLLLLWIFYEV-------LRGR 316

  Fly   534 F--PTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTL 596
            :  .:.|:.:|.|                      ::....|:.|...|::..|.|.|...:::|
  Fly   317 WRRHSRLQSIGWL----------------------VLATLVSSNYVGKLLNLFTDPPSLPPVNSL 359

  Fly   597 QEIYSNKMTVMG-TSEH-------------VRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNE 647
            ..:..:.:.::. .||:             ..||.....|...:|..|...|..      ...:|
  Fly   360 AALMESPVRIISIRSEYSAIEFTQRTKYSAAFHLALHASILIGLRNAFNTSYGY------TITSE 418

  Fly   648 HIAVAVSRQHSFYNPRIQRDRLYCF--------------DRRESLYVYLVTMLLPKKYHLLHQ-- 696
            ...:...:|.....|..:..:..||              ..|..|:.|  |:||  :...||.  
  Fly   419 KWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSY--TLLL--RQAGLHDFW 479

  Fly   697 INPVIQHIIESGHMQKWARDLDMRRMIHEEITRVRED-PFKALTFDQFRGAIAFSGGLLLVASCV 760
            :|....:::::|.:               ..|.|.|. ..|.||....|........:||::..:
  Fly   480 VNRGFSYMVKAGKI---------------NFTAVGERYEAKTLTITDLRNVFIIYVSVLLISLIL 529

  Fly   761 FAFELCYVKYV 771
            |..|| :|.:|
  Fly   530 FTCEL-FVSWV 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 13/72 (18%)
Ir94gNP_651147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.