DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir85a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster


Alignment Length:317 Identity:59/317 - (18%)
Similarity:105/317 - (33%) Gaps:107/317 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 ELTWCVARAKRRHGFFNFVATFNAD--------AGF--LIGIFVVTCSLVVWLAQRVSGFQLRNL 530
            ||:....::..:|....|:...:||        |.|  ...|:::...::.|...|::.::    
  Fly   108 ELSLIRKKSAAKHRSHVFLLVRDADTVSDAWMRASFRQFWKIWLLNIVILYWRDGRLNAYR---- 168

  Fly   531 NGYFPTCLRVLGILLNQAIPAQDFP---ITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQ 592
              |.|       .:.|..||..:.|   .||.|||..:      ..|..:..|       |....
  Fly   169 --YNP-------FMDNYLIPVDNKPNEVPTLEQLFPKT------IPNMQRKPL-------RMCIY 211

  Fly   593 IHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQH 657
            ...::.|:..:.|::||         ||.:..|:.|:.                 :..:.::|.|
  Fly   212 KDDVRAIFWRQGTILGT---------DGLLAAYVAERL-----------------NATMMITRPH 250

  Fly   658 SFYNPRIQRDRLYCFDRRESLYVYL---VTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDM 719
            |:.|..:..|  .||......||.:   :..|:|..:                            
  Fly   251 SYNNHNLSSD--ICFLEVAKEYVDVAMNIRFLVPDTF---------------------------- 285

  Fly   720 RRMIHEEITRVRED-----PFKALTFDQFRGAIAFSGGL---LLVASCVFAFELCYV 768
            |:.....::..|:|     | ||.|...|.......|.|   |::.|.:.|...||:
  Fly   286 RKQAESTVSHTRDDLCVIVP-KAKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Ir85aNP_649833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.