DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir68b

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:489 Identity:97/489 - (19%)
Similarity:159/489 - (32%) Gaps:196/489 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 AIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSI--------EMQGE---NSNLYHLFQQLIDGE 448
            |:|.:..::.|...:.|:   ..:.:.|.|:.|:        |..|.   |.|        ..|.
  Fly   204 AMPRSPVETAGYQAVDGV---AARVVGEMLNASVTYVFPEDNESYGRCLPNGN--------YTGV 257

  Fly   449 IEMIVGGIDEDPSISQFVSSSI--------PYHQDELTWCVARAKRRHGFFNFVATFNADAGFLI 505
            :..||||.......|:||...|        ||.:..|...|..:..:..:..||..|.....:|:
  Fly   258 VSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVWYLL 322

  Fly   506 GIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQ---DFPITLRQLFAL--- 564
            .:.::...||.|:.||                       |.:.||.:   .|..|..::..:   
  Fly   323 LVTLLVVVLVFWVMQR-----------------------LQRRIPRRGVIQFQATWYEILEMFGK 364

  Fly   565 -----------------SFLMGFFFSNTYQSFLISTLTTP-------RSSYQ---------IHTL 596
                             :||||:...    |:::||:...       |.||:         :|..
  Fly   365 THVGEPAGRLSSFSSMRTFLMGWILF----SYVLSTIYFAKLESGFVRPSYEEQVDRVDDLVHLD 425

  Fly   597 QEIYSNKMTVM------GTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSR 655
            ..||:  :|.|      ..:||.                    |.|   |.:.::...:.:|.  
  Fly   426 VHIYA--VTTMYDAVRSALTEHQ--------------------YGL---LENRSRQLPLGIAT-- 463

  Fly   656 QHSFYNPRI-QRDRLYCF-------------------DR------RESLYVYLVTMLLPKKYHLL 694
              |:|.|.: :|||...|                   :|      ||.|...:.|.:||:....|
  Fly   464 --SYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFL 526

  Fly   695 HQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFK----------------------- 736
            |::..:....:|.|..:.| |.:|:       ||||...|..                       
  Fly   527 HRLESLYSGFLEHGFFEHW-RQMDL-------ITRVGASPDAEEFLEDLGDQTDTDSGSNELAIR 583

  Fly   737 ----ALTFDQFRGAI-AFSGGLLLVASCV-FAFE 764
                .||.|..:||. .:|.|:.:  ||: ||.|
  Fly   584 NKKVVLTLDILQGAFYLWSVGIGI--SCLGFAVE 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 19/85 (22%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 62/337 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.