DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir67b

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:522 Identity:106/522 - (20%)
Similarity:178/522 - (34%) Gaps:131/522 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 NSSEPEAIIEEFFRAKFEDKFPR---DLSGCPLTASFRPWEPYIFRNSEEQPVDDYY--YGLQGD 366
            |....:.:|:.|.|. |.:.|..   .|.|.....:|.|::.....|.:.  :.::|  ...:.|
  Fly   113 NGGSYDKLIQIFSRC-FNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKS--IKEFYSLSRKKMD 174

  Fly   367 EDDYNDTS-------PNYGESDDESYADPGEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERL 424
            .:.||.||       |.:....|..                    .:|.|:|....|:.......
  Fly   175 LNGYNITSGLVIAGAPRWFSFRDRQ--------------------NRLILTGYMLRMIVDFTNHF 219

  Fly   425 HVSIEMQG---ENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYHQDELTWC---VAR 483
            :.|:.:..   .|..|..|..:.||....:|       ..:..|..|:|.|.::    |   |..
  Fly   220 NGSVRLMNVLTVNDGLELLANRTIDFFPFLI-------RPLKSFSMSNILYLEN----CGLIVPT 273

  Fly   484 AKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQA 548
            ::....:...:..:..|......|.::.||    ||.|:......:::..|...||::..|..  
  Fly   274 SRPLPNWVYLLRPYAFDTWIAWLIMLIYCS----LALRILSKGQISISAAFLKVLRLVMYLSG-- 332

  Fly   549 IPAQDF---PITLRQ-LFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGT 609
              ::|.   |.|.|. ||.:....||..:|.|.:.|.|.........||:|.::           
  Fly   333 --SRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWED----------- 384

  Fly   610 SEHVRHLNKDGEIF-----------KYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPR 663
                  |:|...|:           |.|.::.::...:|..|..........:..|..||.:   
  Fly   385 ------LDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGF--- 440

  Fly   664 IQRDRLYCFDRRE-SLY--VYLVTMLLPKKYHLLHQ----------------INPVIQHIIESGH 709
                    |||.: :||  .:|...:..|..|||:|                .|..::.|.|||.
  Fly   441 --------FDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGI 497

  Fly   710 MQKWARDLDMRRMIHEEITRV--REDPFKALTFD-QFRGAIA--FSGGLLLVASCVFAFELC--Y 767
            ..| .:|...|..|...:..:  |:...:..:.| ::...||  :.|||.|...| |..||.  |
  Fly   498 YLK-MKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLTLATVC-FLLELLIGY 560

  Fly   768 VK 769
            .|
  Fly   561 AK 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 14/69 (20%)
Ir67bNP_648393.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.