DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir56b

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:420 Identity:76/420 - (18%)
Similarity:150/420 - (35%) Gaps:108/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 KLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLF--------------QQLIDGEIEMIVGGIDE 458
            |..|...|:|:..||..|            |.||              |.:|.|:..:.:.|:..
  Fly    35 KFCGPYMEIVKHFAEVYH------------YQLFLDSLESLPKKSVVEQDIISGKYNLSLHGVII 87

  Fly   459 DPSISQ--FVSSSIPYHQDELTWCVARAKRRH-----------GFFNFVATFNADAGFLIGIFVV 510
            .|..:.  |.::...|..:.:|.||.......           |.:.:...|       :|.|.|
  Fly    88 RPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLF-------LGTFYV 145

  Fly   511 TCSL--VVWLAQRVSGFQLRNLNGYFPTCLRVLGIL-----LNQAIPAQDFPITLRQLFALSFLM 568
            ...|  |.|   |..|...|:   |....|..:.:|     :|.::..:...|.:...:.|.::.
  Fly   146 ALLLRYVHW---REPGNATRS---YTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIF 204

  Fly   569 GFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMC 633
            ||..:|.:.|.:.:....|.....|.|..::..:::.::                  |.:     
  Fly   205 GFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIV------------------IHD----- 246

  Fly   634 YNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESL----YVYLVTMLLPKKYHLL 694
             :|::.|......:.:..:.||.:::.   :.:|....|:|::.:    |.:|..:.....::.|
  Fly   247 -SLLEELRWLPVYQALLASPSRSYAYV---VTQDAWLFFNRQQKVLIQPYFHLSKVCFGGLFNAL 307

  Fly   695 ---------HQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVRED--PFKALTFDQFRGA-I 747
                     ..:|..|.::.::|....| .:|..|........:|..|  |.:.|..:.|..| |
  Fly   308 PMASNASFADSLNKFILNVWQAGLWNYW-EELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTAWI 371

  Fly   748 AFSGGLLLVASCVFAFELCYVKYVYRTEKR 777
            ..|.| :.::|..|..||    :::|.::|
  Fly   372 VLSAG-IPISSLAFCLEL----FIHRRKQR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 17/82 (21%)
Ir56bNP_611430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.