DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir52a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a / 36715 FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster


Alignment Length:523 Identity:108/523 - (20%)
Similarity:197/523 - (37%) Gaps:142/523 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 YIFRNSEEQPV-------DDYYYGLQGDEDDYNDT--------SPNYGE----SDDESYADPGED 391
            |:..|||.:.|       :.:...:...:.|.:||        :|||.|    .|...|.:..::
  Fly   119 YLEDNSEPESVCMRYSLKEQHNIAMVKSDFDQSDTFYSCRLFQTPNYVEGHFFKDQPIYIENFQN 183

  Fly   392 ---------GDGAIPDT---ETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQL 444
                     .|..:|.|   ..:..|:.|:.|....|:.|.|::|:..:... :.|.|......:
  Fly   184 MRGATIRTVADSLVPRTILYRDEKSGETKMMGYLGHMINTYAQKLNAKLHFI-DTSKLGAKKPSV 247

  Fly   445 IDGEIEMIVGGIDED-PSISQFVSSSIPYHQDELTW--------CVARAKRRHGFFNFVATFNAD 500
            :|     |:..::|| ..|...::||:.:...:..|        |:.........:|.|.:...|
  Fly   248 LD-----IMNWVNEDIVDIGTALASSLQFKNMDSVWYPYLLTGYCLMVPVPAKMPYNLVYSMIVD 307

  Fly   501 AGFLIGIFVVTC--SLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLN----QAIPAQDFPI--- 556
            ...|..|||:.|  |:::...|.:|   .:||.        :..||||    :.:..|.||.   
  Fly   308 PLVLSIIFVMLCLFSVLIIYTQHLS---WKNLT--------LANILLNDKSLRGLLGQSFPFPPN 361

  Fly   557 TLRQLFALSFLMGF---FFSNTYQSFLISTLTTPRSSYQIHTLQEIYS------------NKMTV 606
            ..:.|..:.|::.|   ..:..|:::|.|..|.|.|...|.:.::|.:            |.:|.
  Fly   362 PSKHLKLIIFVLCFASVMITTMYEAYLQSYFTQPPSEPYIRSFRDIGNSSLKMAISRLEVNVLTS 426

  Fly   607 MGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYC 671
            :..| |.|.:::|..:             :.|.|     :|::.:..|...||..| :..||...
  Fly   427 LNNS-HFREISEDHLL-------------IFDDL-----SEYLVLRDSFNTSFIFP-VSVDRWNG 471

  Fly   672 FDRRESLYV----YLVTMLL---------PKKYHLLHQINPVIQHIIESGHMQK---------WA 714
            ::.::.|:.    ||.|.|.         |.:.:|.|      :|:.|. ||.:         |.
  Fly   472 YEEQQKLFAEPAFYLATNLCFNQFMLFSPPLRRYLPH------RHLFED-HMMRQHEFGLVTFWK 529

  Fly   715 RD--LDMRRM---IHEEITRVREDPFKALTFDQFRGAIAFSGGLLLVASCVFAFELCYVKYVYRT 774
            ..  ::|.|:   ..|:::|.|.:....|..|       .|..|.|....:|....|::..:.|.
  Fly   530 SQSFIEMVRLGLASMEDLSRKRNEEVSLLLDD-------ISWILKLYLGAMFISSFCFILEILRC 587

  Fly   775 EKR 777
            .:|
  Fly   588 GER 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 15/67 (22%)
Ir52aNP_611041.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.