DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir20a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_608456.1 Gene:Ir20a / 33126 FlyBaseID:FBgn0031181 Length:563 Species:Drosophila melanogaster


Alignment Length:419 Identity:82/419 - (19%)
Similarity:142/419 - (33%) Gaps:104/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 IPDTE-------TQSGGKLKLSGIEYEMVQTIAERLHVSIEM------QGENSNLYHLFQQLIDG 447
            |||..       ..:.|..:::|..::.:.|.|.||:..:|:      .|..|:..::.:....|
  Fly   192 IPDLSPPNTFFYRDARGDNQVTGYLWDFLATFAGRLNAGLEVVRPSWRAGSASDSSYMLEYSAKG 256

  Fly   448 EIEMIVGGIDEDP-------SISQF-----VSSSIPYHQDELTWCVARAKRRHGFFNFVAT---F 497
            .|::   |:....       :|.|:     |||          ||......:.     :||   |
  Fly   257 LIDV---GLTTTLITKWNLWAIHQYTYPLLVSS----------WCTMLPVEKP-----LATPDLF 303

  Fly   498 NADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPITLRQLF 562
            .......:.:.::...||.||..|    |||        ||    ..|..:.||:..|       
  Fly   304 GRIVCPTLAMTLLLIILVTWLVFR----QLR--------CL----TRLKNSRPARIVP------- 345

  Fly   563 ALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIR 627
               .|:......|..:.|:|.|..|....:|.:.:::......::|...  ...|.||.    .|
  Fly   346 ---HLLTLLLLTTCSAQLLSLLIFPPYHVRIASFEDLLRGDQKILGMRN--EFYNFDGA----FR 401

  Fly   628 EKFQMCYNLVDCLNDAAQ-NEHI-------------AVAVSRQHSFYNPRIQRDRLYCFDRRESL 678
            .::...:.|:|..|:... ..|.             .|..::|..|..|..:..:..||      
  Fly   402 ARYAGVFYLIDDPNELYDLRNHFNTTWAYTMPYIKWLVIKTQQRHFSKPLFRWSKDLCF------ 460

  Fly   679 YVYLVTMLL--PKKYHLLHQINPVIQHIIESGHMQKWARD--LDMRRMIHEEITRVRE-DPFKAL 738
            :.::.|.::  |...: ...|......|.::|.|:.|.|.  .||.:.....|....: :..|.|
  Fly   461 FDFMPTSVIVAPDSIY-WESIKDFTFRIHQAGLMKHWIRKSFYDMIKAGKMSIKDYSDLETLKPL 524

  Fly   739 TFDQFRGAIAFSGGLLLVASCVFAFELCY 767
            ............|..:.|||.:|..||.|
  Fly   525 NIGDLEIVWRVCGAAIAVASAIFIMELLY 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 16/84 (19%)
Ir20aNP_608456.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.