DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir11a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:423 Identity:95/423 - (22%)
Similarity:168/423 - (39%) Gaps:97/423 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 YADPGEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQ---------GENSNLYHL 440
            :.||....:.:||..:        |:||:::::|.:|:.|...|::.         || .|:...
  Fly   257 HKDPPPASNVSIPAED--------LAGIDWDLLQLLAKALKFRIQLYMPQEPSQIFGE-GNVSGC 312

  Fly   441 FQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYHQDELTWCVARAKRRHGFFNFVATFNADAGFLI 505
            |:||.||.:.:.:||:..........|.|..|||......|.|.:........:..|.   |.|.
  Fly   313 FRQLADGTVSIAIGGLSGSDKRRSLFSKSTVYHQSNFVMVVRRDRYLGRLGPLILPFR---GKLW 374

  Fly   506 GIFVVTCSLVV----WLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPIT--LRQLFAL 564
            |:.:|...|.|    ||..|:         |.......:|.:::...||....|..  ||.|.| 
  Fly   375 GVIIVILLLAVLSTCWLRSRL---------GLSHPIEDLLTVIVGNPIPDHRLPGKGFLRYLLA- 429

  Fly   565 SFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREK 629
                         |:::.||.. |.:||        :....|:..|.| |.|.||  :...|::.
  Fly   430 -------------SWMLLTLVL-RCAYQ--------ARLFDVLRLSRH-RPLPKD--LSGLIKDN 469

  Fly   630 FQM--------------CYNLVDC------LNDAAQNEHI-AVAVSRQHSFYN---PRIQRDRLY 670
            :.|              |...:|.      :..||.:|.: .:|:....:::|   |.|.|....
  Fly   470 YTMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWNHKHPNISRLTFV 534

  Fly   671 CFDRRESLYVYLVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRV-REDP 734
                |:.:|:|.:.:..|:::.|...|:..|:.::.:|.|    ..::.|.|.:|...:| ..||
  Fly   535 ----RQPIYMYHLVIYFPRRFFLRPAIDRKIKQLLSAGVM----AHIERRYMQYENKRKVASNDP 591

  Fly   735 --FKALTFDQFRGAIAFSGGLLLVASCVFAFEL 765
              .:.:|.....||....|.::::|:.:|..||
  Fly   592 VLLRRITKSIMNGAYRIHGLVIVLATGMFILEL 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 21/75 (28%)
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.