DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Ir94a

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster


Alignment Length:413 Identity:82/413 - (19%)
Similarity:152/413 - (36%) Gaps:79/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 EMVQTIAERLHVSIEMQGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYH------ 473
            ||....|.|.:.::.:|          .:.|..:||:.....|.|..|....|.:..:|      
  Fly   218 EMFTEYARRYNSTLRIQ----------NRTIKEDIEITEDNYDIDMKIQLHNSQNFLHHMNIAMD 272

  Fly   474 --QDELTWCVARAKRRHGFFNF----VATFNADAGFLIGIFVVTCSLVVWLAQRVSG--FQLRNL 530
              .:.|...|..|....|...|    |.|....|.....|||:...|.|:::.|.:|  |.:|..
  Fly   273 IGSNSLIILVPCATELRGLDIFKELGVRTLTWLALLFYIIFVLVEMLFVFISNRFNGRNFTMRYT 337

  Fly   531 NGYFPTCLRVLGILLNQAIPAQD-FPITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIH 594
            |....  ||.:..:|.|..|..: :.::::..|....|.|..|...:...|.|.||......||.
  Fly   338 NPLIN--LRAVRAILGQTSPISNRYSLSIQHFFVFMSLFGTLFGGFFDCKLRSFLTKRPYYSQIE 400

  Fly   595 TLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQN----------EHI 649
            ...|:..:.:||:     |.|..:     ::|.::..     .:...|...|          .|:
  Fly   401 NFSELRKSGVTVV-----VDHTTR-----QFIEQEIN-----ANFFRDEVPNVRTTTIQELINHV 450

  Fly   650 AVAVSRQHSFYNPRIQ-----------RDRLYCFDRRESLYVYL-VTMLLPKKYHLLHQINPVIQ 702
             .:..|:.:|....|.           ..::.|..:..::...: :|..:.:.....|.:...|.
  Fly   451 -YSYDRKFAFVANSIPWRTFREEMKSINQKILCDSKNLTILENVPLTFSIRRNAIFSHHLRNFII 514

  Fly   703 HIIESGHMQKWARDLDMRRMIHEEI-TRVREDPFK----ALTFDQFRGAIAFSGGLLLVASCVFA 762
            :..:||.:..|.:...  ::|.:.| |.:||...:    .|:||.|:...|......:::..||.
  Fly   515 NAADSGMITCWFKMAG--KVIRKHIKTTLRESEQQPSHLPLSFDHFKWLWAVLCIAYVMSFMVFV 577

  Fly   763 FELCYVKYVYRTEKRERKTKKIT 785
            .|:.:.||       :|:|:.::
  Fly   578 MEILWSKY-------QRRTRSVS 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 13/67 (19%)
Ir94aNP_732699.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009985
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.