DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and GRIN2C

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:XP_016880033.1 Gene:GRIN2C / 2905 HGNCID:4587 Length:1337 Species:Homo sapiens


Alignment Length:295 Identity:60/295 - (20%)
Similarity:105/295 - (35%) Gaps:100/295 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 DPGEDGDGAIPDT--------ETQSGG------KLKLSGIEYEMVQTIAERLHVSIEM----QGE 433
            |||.  .|.:|:|        .|.|.|      ||...|...::::.:|..:..|.::    .|:
Human   495 DPGT--GGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTNGK 557

  Fly   434 NSNLYHLFQQLIDGEI-----EMIVGGIDEDPSISQFVSSSIPYHQDELTWCVARAKRRHGFFNF 493
            :..........:.||:     :|.:|.:..:...|:.|..|:|:.:..::..|||:.        
Human   558 HGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSN-------- 614

  Fly   494 VATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILL-----------NQ 547
             .|.:..|      |:...|..||:..             |..||.|:.|.:           ||
Human   615 -GTVSPSA------FLEPYSPAVWVMM-------------FVMCLTVVAITVFMFEYFSPVSYNQ 659

  Fly   548 AI--------PAQDFPITLRQLFALSF------------------LMGFFFSNTYQSFLISTLTT 586
            .:        ||.....::..|:||.|                  |:..||:..:    :::.|.
Human   660 NLTRGKKSGGPAFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIF----LASYTA 720

  Fly   587 PRSSYQIHTLQEIYSNKMTVMGTSEHVR-HLNKDG 620
            ..:::.|   ||.|.:  ||.|.|:... ||...|
Human   721 NLAAFMI---QEQYID--TVSGLSDKKSLHLENTG 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 12/75 (16%)
GRIN2CXP_016880033.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.