DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and Grik4

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_780690.2 Gene:Grik4 / 110637 MGIID:95817 Length:956 Species:Mus musculus


Alignment Length:239 Identity:41/239 - (17%)
Similarity:91/239 - (38%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 GKLKLSGIEYEMVQTIAE--RLHVSIEMQGE--------NSNLYHLFQQLIDGEIEMIVGGIDED 459
            |..:..|...:|::.:||  |.:..|.:.|:        |.....:..:||..:.::.|.|:...
Mouse   440 GNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELIARKADLAVAGLTIT 504

  Fly   460 PSISQFVSSSIPYHQDELTWCVA-----RAKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLA 519
            ....:.:..|.|:    :|..::     ...||.|:|:|:..|:......:.:..:..|.|::|.
Mouse   505 AEREKVIDFSKPF----MTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLV 565

  Fly   520 QRVSGFQLRN------------LNGY-------FPTCLRVLGILLNQAIPAQDFPITLRQLFALS 565
            .|::.::..:            :|.|       ||     :|..:.|........::.|.:..:.
Mouse   566 ARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP-----VGGFMQQGSTIAPRALSTRCVSGVW 625

  Fly   566 FLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGT 609
            :.......::|.:.|.:.||..|....|.::.::........||
Mouse   626 WAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGT 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 14/76 (18%)
Grik4NP_780690.2 Periplasmic_Binding_Protein_type1 24..402 CDD:385651
PBP2_iGluR_kainate_KA1 415..785 CDD:270442 41/239 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..956
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.