DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir87a and grik4

DIOPT Version :9

Sequence 1:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster
Sequence 2:XP_031761990.1 Gene:grik4 / 100490768 XenbaseID:XB-GENE-1011875 Length:962 Species:Xenopus tropicalis


Alignment Length:294 Identity:48/294 - (16%)
Similarity:109/294 - (37%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 GKLKLSGIEYEMVQTIAE--RLHVSIEMQGE--------NSNLYHLFQQLIDGEIEMIVGGIDED 459
            |..:..|...:|::.:|.  |.:..|.:..:        |.....:..:||..:.::.|.|:...
 Frog   443 GNDRYEGFCVDMLKELAAILRFNYKIRLVADGVYGVPELNGTWTGMVGELISRKADLAVAGLTIT 507

  Fly   460 PSISQFVSSSIPYHQDELTWCVARAKRRH-----GFFNFVATFNADAGFLIGIFVVTCSLVVWLA 519
            ....:.:..|.|:    :|..::...|.|     |:|:|:..|:......:.:..:..|.|::|.
 Frog   508 AEREKVIDFSKPF----MTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLV 568

  Fly   520 QRVSGFQLRN------------LNGY-------FPTCLRVLGILLNQAIPAQDFPITLRQLFALS 565
            .|::.::..:            :|.|       ||     :|..:.|........::.|.:..:.
 Frog   569 ARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP-----VGGFMQQGSTIAPRALSTRCVSGVW 628

  Fly   566 FLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIR-EK 629
            :.......::|.:.|.:.||..|....|.::.::........||.    |.......|:..| :.
 Frog   629 WAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTTIEYGTI----HGGSSMTFFQNSRYQT 689

  Fly   630 FQMCYNLVDCLNDA----AQNEHIAVAVSRQHSF 659
            :|..:|.:.....:    :..|.||..::..::|
 Frog   690 YQRMWNYMHSKQPSVFVKSTEEGIARVLNSNYAF 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 12/76 (16%)
grik4XP_031761990.1 Periplasmic_Binding_Protein_type1 23..400 CDD:415822
PBP2_iGluR_kainate_KA1 414..788 CDD:270442 48/294 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.