Sequence 1: | NP_524344.1 | Gene: | yellow-e / 41653 | FlyBaseID: | FBgn0041711 | Length: | 530 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009609.1 | Gene: | YBR053C / 852342 | SGDID: | S000000257 | Length: | 358 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 72/197 - (36%) | Gaps: | 49/197 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 216 GKDVTWRVSHPAMYPDPD---------------FAQSEIHEHRFVLMDGVVGLTFDERTG---VV 262
Fly 263 YFQ--PLATDRVFSVHKNVLRAGPLPDGKMLDVKLVGKKSSQGIGLAVSPFDSSLIFSPLSETAI 325
Fly 326 AS-----WNPTTNQQSVLAFDRDQ-LQFVAD---ITTTKSEPGVIYAIASKFHRFFLKNLNPNEF 381
Fly 382 NN 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yellow-e | NP_524344.1 | MRJP | 120..393 | CDD:281074 | 44/197 (22%) |
YBR053C | NP_009609.1 | YvrE | 1..345 | CDD:225921 | 44/197 (22%) |
WD40 repeat | 150..186 | CDD:293791 | 12/47 (26%) | ||
WD40 repeat | 199..248 | CDD:293791 | 10/51 (20%) | ||
WD40 repeat | 259..294 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3386 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |