DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e and yellow-k

DIOPT Version :9

Sequence 1:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:345 Identity:67/345 - (19%)
Similarity:133/345 - (38%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NPQNVLITGLAVTDDRIFVATPKLFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFSNTGRSDFNCS 115
            |..:..:..|::...|:|::.....:..|:.:.......:...||: .||.....:.|..| :||
  Fly    31 NESSYKVRHLSMHFSRVFLSVNVESNDAPTLIEAQWPVSYFPMPTV-VFPHIDVHSMGDHD-DCS 93

  Fly   116 DLILTSVYRLRVDSCNRIWLLDAGISRSLEDYEITCPPKILVVDLATDRV-VRRIDFPPEVLRGE 179
              ::...:..:||:.:|:|::|.|...|      ||.|::.|.||..:.. :.|||....:...:
  Fly    94 --LVQQAHWSQVDALSRLWVMDIGFPGS------TCSPRLFVFDLMRNNAELLRIDCGHHIGAND 150

  Fly   180 SLFTNMVIDETTAKGCD-DVFVYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHEHR 243
            :.|..:.:. ..:.||: :..:|......|.|:.||. .:.||                    ||
  Fly   151 THFLTVQMG-PKSPGCEHERHIYFILGKVPEILAYDI-LEQTW--------------------HR 193

  Fly   244 FVLMDGVVGLTFDERTGVVYFQPLATDRVFSVHKNVLRAGPLPDGKMLD----VKLVGKKSSQGI 304
            ..|...    .::........:|:  |.:|.:...::.:.  .||.:..    :::.||..    
  Fly   194 LSLESN----KYENMNQSFPIKPV--DFIFGIQGELILSD--QDGDLYSTVDRLEIEGKSE---- 246

  Fly   305 GLAVSPFDSSLIFSPLSETAIASWNPTTNQQSVLAFDRDQLQFV-------------ADITTTKS 356
             ||..|.::|:..:.|.....:|       :|::..:...|.:|             |:||...:
  Fly   247 -LASKPINNSIKLTHLGSLLGSS-------RSMIIDNFGTLYYVIPKFGAVVRCAKLANITAEGN 303

  Fly   357 EPGVIYAIASKFHR-FFLKN 375
            |  :||..:....: ||..|
  Fly   304 E--IIYITSKNIQQIFFTSN 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 54/276 (20%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.