DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e and regucalcin

DIOPT Version :9

Sequence 1:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster


Alignment Length:305 Identity:60/305 - (19%)
Similarity:107/305 - (35%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PDWTFSNTGRSDFNCSDLILTSVYRLRVD-SCNRIWLLD------AGISRSLE----DYEITCPP 153
            |.|   :..|......||...|:  ||.| :.|:::...      ||....:|    ::.:.|..
  Fly    35 PHW---DVARQSLYYVDLEAGSL--LRYDYAQNKVYKTKIEGETLAGFVLPVEGRPQEFAVGCGR 94

  Fly   154 KILVVD----LATDRVVRRIDFPPEVLRGESLFTNMVIDETTAKGCDDVFVYITDTVEPGIIVYD 214
            ::::|:    ..:.:|||.: |..:.|..::...:..:| ...:.......||.|..|     :.
  Fly    95 RVVIVNWDGVSPSAKVVRTL-FEVQPLMEKNRLNDAKVD-PRGRFFGGTMRYIGDEFE-----FR 152

  Fly   215 SGKDVTWRVSHPAMYPDPDFAQSEIHEHRFVLMDGVVGLTFDERTGVVYFQPLATDR-------- 271
            .|:...|...........|...|.             ||.:||:....|:.. .||.        
  Fly   153 HGELYRWEAGGQVSVIKGDVGISN-------------GLAWDEKAKKFYYID-TTDYEVKSYDYD 203

  Fly   272 -----------VFSVHKNVLRAGPLPDGKMLDVKLVGKKSSQGIGLAVSPFDSSLIF--SPLSET 323
                       :|::.||..:...||||..:|        ::| .|.|:.|:.:.|:  :|.:..
  Fly   204 FETGVASNPKVIFNLRKNSPKDHLLPDGLTID--------TEG-NLYVATFNGATIYKVNPNTGK 259

  Fly   324 AIASWNPTTNQQSVLAFDRDQLQFVADITTTK-SEP---GVIYAI 364
            .:......|.|.:..||....|..:...|..| .:|   |..|.:
  Fly   260 ILLEIKFPTKQITSAAFGGPNLDILYVTTAAKFDQPAPAGTTYKV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 55/285 (19%)
regucalcinNP_727588.2 SGL 31..290 CDD:285626 56/289 (19%)
NHL <229..302 CDD:302697 19/81 (23%)
NHL repeat 229..259 CDD:271320 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.