DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-k

DIOPT Version :9

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:313 Identity:69/313 - (22%)
Similarity:116/313 - (37%) Gaps:92/313 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YPSYQWHSSHGANCDGLTSVYRVH---IDACGQMWVLDSGEIEFV-QHCAPQVMVFDLATD--QL 182
            :|....||.  .:.|..:.|.:.|   :||..::||:|.|   |. ..|:|::.||||..:  :|
  Fly    78 FPHIDVHSM--GDHDDCSLVQQAHWSQVDALSRLWVMDIG---FPGSTCSPRLFVFDLMRNNAEL 137

  Fly   183 I-----HRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCK-DVFAYLADPTSKAIVVYDVVGQSS 241
            :     |.....:|.           |..::..|.|..|: :...|........|:.||::.|:.
  Fly   138 LRIDCGHHIGANDTH-----------FLTVQMGPKSPGCEHERHIYFILGKVPEILAYDILEQTW 191

  Fly   242 WRI---ENKFTYPDAKFGTHTV---AGESFELL----DGPLALATTPLGLGLRRHLIFHALSNEL 296
            .|:   .||:...:..|....|   .|...||:    ||.|......|.:..:..|....::|.:
  Fly   192 HRLSLESNKYENMNQSFPIKPVDFIFGIQGELILSDQDGDLYSTVDRLEIEGKSELASKPINNSI 256

  Fly   297 ELAIPLDILNNATNWQKGLSSSLSE--------FTVLGKRG--IQCASHA-ISRQGFLFCGFLEP 350
            :|          |:....|.||.|.        :.|:.|.|  ::||..| |:.:|         
  Fly   257 KL----------THLGSLLGSSRSMIIDNFGTLYYVIPKFGAVVRCAKLANITAEG--------- 302

  Fly   351 IGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGREELWLLSDRL 403
                         .|.:.:.:.|...:.|.|           .:.||:||||:
  Fly   303 -------------NEIIYITSKNIQQIFFTS-----------NDALWVLSDRV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 65/296 (22%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.