DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and y

DIOPT Version :9

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster


Alignment Length:404 Identity:115/404 - (28%)
Similarity:190/404 - (47%) Gaps:41/404 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSLGY 109
            :.|..|.:.||:.:.:||.|.:|.|.|.:.:|:.::.:    |.  |.|||.||:..|:|.:|.|
  Fly    29 YSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHF----GN--RLFVTVPRWRDGIPATLTY 87

  Fly   110 VTNVQRENGS-EIQAYPSYQWHSSHGANC-DGLTSVYRVHIDACGQMWVLDSGEIEF----VQHC 168
            :...:...|| |:..||  .|.|:...:| :.:|:.||:.:|.||::||||:|.:..    ...|
  Fly    88 INMDRSLTGSPELIPYP--DWRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPC 150

  Fly   169 APQVMVFDLATDQLIHRYRLP--ETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAI 231
            ...|.||||.||..|.||.||  :|:....::   ||..||     ...|.|.:||.||.....:
  Fly   151 PYAVNVFDLTTDTRIRRYELPGVDTNPNTFIA---NIAVDI-----GKNCDDAYAYFADELGYGL 207

  Fly   232 VVYDVVGQSSWRIE-NKFTYPDAKFGTHTVAGESFEL-LDGPLALATTPLGLGLRRHLIFHALSN 294
            :.|......|||.. :.:.:||...|...|||.:|:. .:|...::.:|:.....|.|.|..|::
  Fly   208 IAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLAS 272

  Fly   295 ELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRGIQCASHAISR----QGFLFCGFLEPIGIFG 355
            ..:.|:...||.:.|..:    .|..:|..|.:||..  ||..||    .|......::...:..
  Fly   273 HRQFAVSTRILRDETRTE----DSYHDFVALDERGPN--SHTTSRVMSDDGIELFNLIDQNAVGC 331

  Fly   356 WDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGREELWLLSDRLQKIFAGTIDYREINYRV 420
            |....||:.:...::..:...|.|.:.:||     |..:.:|:||||:.......:||.:.|:|:
  Fly   332 WHSSMPYSPQFHGIVDRDDVGLVFPADVKI-----DENKNVWVLSDRMPVFLLSDLDYSDTNFRI 391

  Fly   421 MRCDVDDLLQGRGC 434
            ....:..|::...|
  Fly   392 YTAPLATLIENTVC 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 84/304 (28%)
yNP_476792.1 MRJP 119..405 CDD:308585 84/304 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D202564at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.