DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e3 and RGN

DIOPT Version :9

Sequence 1:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_004674.1 Gene:RGN / 9104 HGNCID:9989 Length:299 Species:Homo sapiens


Alignment Length:224 Identity:47/224 - (20%)
Similarity:65/224 - (29%) Gaps:77/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HQWTNLSLGDDLSKGNRFLPVDVDIEYGDEGRHRTFLTIPRLGM---ATPFTLATVIAEHNELVE 87
            ||....||..|......|..||:.........|:.|..|..|..   |..:.|.|      ..:.
Human   130 HQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQT------GQIS 188

  Fly    88 NPRLEPYPNEEWHVPPNNCSGITSAIRTYIDECWRLWVV--DSGQVNSLQLCPPQILTFDLVKDE 150
            |.|......:|..:|...|          ||...:|||.  :.|:|          :..|.|..:
Human   189 NRRSVYKLEKEEQIPDGMC----------IDAEGKLWVACYNGGRV----------IRLDPVTGK 233

  Fly   151 LVQRHALPPDSYIPSVSIFTALVVDLAERGTPNRCVGGR----AYIADAWGYGLIVFDSLTGRSW 211
            .:|...||.|.                   |.:.|.||:    .|:..|                
Human   234 RLQTVKLPVDK-------------------TTSCCFGGKNYSEMYVTCA---------------- 263

  Fly   212 RIEHESMKPSPLLRLGRSSNSQAGIFTVS 240
               .:.|.|..|||    .....|||.::
Human   264 ---RDGMDPEGLLR----QPEAGGIFKIT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 27/137 (20%)
RGNNP_004674.1 SGL 16..264 CDD:400653 39/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.