DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e3 and yellow-k

DIOPT Version :9

Sequence 1:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:353 Identity:77/353 - (21%)
Similarity:132/353 - (37%) Gaps:104/353 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RH------RTFLTI-------PRLGMA----TPFTLATVIAEHNELVENPRLEPYPNEEWHV--P 102
            ||      |.||::       |.|..|    :.|.:.||:              :|:.:.|.  .
  Fly    38 RHLSMHFSRVFLSVNVESNDAPTLIEAQWPVSYFPMPTVV--------------FPHIDVHSMGD 88

  Fly   103 PNNCSGITSAIRTYIDECWRLWVVDSGQVNSLQLCPPQILTFDLVKD--ELVQ----RHALPPDS 161
            .::||.:..|..:.:|...||||:|.|...|  .|.|::..|||:::  ||::    .|....|:
  Fly    89 HDDCSLVQQAHWSQVDALSRLWVMDIGFPGS--TCSPRLFVFDLMRNNAELLRIDCGHHIGANDT 151

  Fly   162 YIPSVSIFTALVVDLAERGTPNRCVGGR-AYIADAWGYGLIVFDSLTGRSW-RIEHES------- 217
            :.        |.|.:..: :|. |...| .|........::.:|.|. ::| |:..||       
  Fly   152 HF--------LTVQMGPK-SPG-CEHERHIYFILGKVPEILAYDILE-QTWHRLSLESNKYENMN 205

  Fly   218 ----MKPSPLLRLGRSS----NSQAGIFTVSLSPSEVEDRFLYFHTLNSFNEMRVPLSLINNETF 274
                :||...: .|...    :.|.|....::...|:|.:                     :|..
  Fly   206 QSFPIKPVDFI-FGIQGELILSDQDGDLYSTVDRLEIEGK---------------------SELA 248

  Fly   275 WKSANASRDSFHSLGTRGIQCESEVMDQSGNLYCSLISLGALVKWEESVSNYTADDLRVVAYNPH 339
            .|..|.|....| ||:......|.::|..|.||..:...||:|:..: ::|.||:...::.....
  Fly   249 SKPINNSIKLTH-LGSLLGSSRSMIIDNFGTLYYVIPKFGAVVRCAK-LANITAEGNEIIYITSK 311

  Fly   340 KIK--FVTGLKINRNSKGEEELWALSSQ 365
            .|:  |.|         ..:.||.||.:
  Fly   312 NIQQIFFT---------SNDALWVLSDR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 62/281 (22%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 29/111 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.