DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e3 and yellow-b

DIOPT Version :9

Sequence 1:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster


Alignment Length:427 Identity:119/427 - (27%)
Similarity:196/427 - (45%) Gaps:52/427 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALFCAVQGQALVLKELHTLHQWTNLSLGDDLSKGN-----------RFLPVDVDIEYGDE-GRH 58
            |.|..||  .||....|...::|..:    |....|           .|.|.:| |.:|.| ..|
  Fly     8 LLLLWAV--SALANDNLRVAYEWREM----DFKYANPDQRWSAIERGEFKPANV-IPFGLEVAGH 65

  Fly    59 RTFLTIPRLGMATPFTLATVIAEHNELVENPRLEPYPNEEWHVPPNNCSGITSAIRTYIDECWRL 123
            |.|:|:||.....|.:|| .:..::...:.|.|:|:|:.:.|........:.|..|...|.|.||
  Fly    66 RLFVTLPRWRDGVPASLA-YLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADRCGRL 129

  Fly   124 WVVD---SGQVNSLQLC-PPQILTFDLVKDELVQRHALPPDSYIPSVSIFTALVVDLAERGTPNR 184
            ||:|   ||.:...::. ..|:|.:||..|:|::||.||. ..:...|:...|.|:.::      
  Fly   130 WVLDSRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVLPA-GQLKQGSLLANLAVEDSD------ 187

  Fly   185 CVGGRAYIADAWGYGLIVFDSLTGRSWRIEHESMKPSPLLRLGRSSNS------QAGIFTVSLS- 242
            |....||.||....||:|:......|||::|....|.|:  .|..|.:      ..|::.::|| 
  Fly   188 CENTFAYAADLGSPGLVVYSWKDEESWRVQHHFFHPDPM--AGNFSINGIEFQWDDGLYGLALSK 250

  Fly   243 PSEVEDRFLYFHTLNSFNEMRVPLSLINNETFWKSANASRDSFHSLGTRG--IQCESEVMD-QSG 304
            |.|.....||||.|.|..|..|..|::.|:|...|....|: |..||:||  .|..:|.:| .:|
  Fly   251 PLETGYATLYFHPLCSTTEFSVDTSILRNKTLATSPMIYRE-FKVLGSRGPNTQAGAEFLDPDTG 314

  Fly   305 NLYCSLISLGALVKWEESVSNYTADDLRVVAYNPHKIKFVTGLKINRNSKGEEELWALSSQPKLF 369
            .|:.:|.:|..:..| .:.::::......:..|...:.|.:.:|::    .::.||.||:|..:|
  Fly   315 VLFYALPNLNEVACW-RTATDFSHSSQSRIHMNNDTLVFPSDIKVD----DQKRLWVLSNQLPVF 374

  Fly   370 VGGDLPANEVKFQIIGCRTADLLANTPCTVGAAETTP 406
            :..:|.|..:.|:|:.....:.:.||.|.:   .|:|
  Fly   375 IYDELYAGSINFRILTASVKEAIENTACEI---RTSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 86/300 (29%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 86/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.