DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and AT1G07080

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_563779.1 Gene:AT1G07080 / 837219 AraportID:AT1G07080 Length:265 Species:Arabidopsis thaliana


Alignment Length:241 Identity:58/241 - (24%)
Similarity:97/241 - (40%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGP 85
            |:.||.:.:|||||||..:.||...:....:.:|..:|:|...|:|.::.  :...||..|.||.
plant    35 SSPKVSVGLYYESLCPYCSSFIVNHLAKLFEDDLISIVDLHLSPWGNTKL--RSDNVTAVCQHGA 97

  Fly    86 NECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPGQRCASENHINNWE 150
            .||:.:.|.||||:                      ...|...:|| .:|..::..:|:..:.||
plant    98 FECFLDTVEACAID----------------------AWPKVSDHFP-FIYCVEKLVTEHKYDKWE 139

  Fly   151 N-----------IKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFN-----EQFDKKVNDRA 199
            .           :..|.:|..|:.|.......|..|:.|...||.::.:     |.::       
plant   140 TCYEKLNLNSKPVADCLSSGHGNELALHYAAETNALQPPHKYVPWVVVDGQPLYEDYE------- 197

  Fly   200 QVNLVGTICQ-YVSAPQPRICNQHNGASTPSLASVSAILSSLLGLW 244
              |.:..||: |.....|..|.::  |:...:.||....|.|:. |
plant   198 --NFISYICKAYKGNKVPGACTKY--ATGNFIRSVKLKRSPLVS-W 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 30/116 (26%)
AT1G07080NP_563779.1 GILT 40..144 CDD:308710 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.