DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and OSH1

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_195778.1 Gene:OSH1 / 831721 AraportID:AT5G01580 Length:233 Species:Arabidopsis thaliana


Alignment Length:245 Identity:66/245 - (26%)
Similarity:107/245 - (43%) Gaps:47/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLLMSCLIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQ 73
            |.:..||::.: |:.||.:|:|||:|||..|:||..::....:..|...::|..||:|.:.....
plant    12 CTIFFCLLSLS-SSQKVTLSLYYEALCPFCAEFIVNRLPKIFETGLISSIDLQLVPWGNAAIRPD 75

  Fly    74 GSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQ-------VEYTRESLTMD-----FINCLMKA 126
            |   |..|.||..||..|.:|||||     |:|.       ..|..|.|.::     :.:||...
plant    76 G---TILCQHGEAECALNAIHACAI-----NAYPDVMKHFGYIYCTEQLVLENKLEKWADCLEMV 132

  Fly   127 GKNFPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQF 191
            |.:         |.|.:.:||.:           |:.|.::..|.|..|......||.::.|   
plant   133 GLS---------RAAVDCYINGY-----------GNQLEQRYAEETSELYPAHRFVPWVVVN--- 174

  Fly   192 DKKVNDRAQVNLVGTICQ-YVSAPQPRICNQHNGASTPSLASVSAILSSL 240
            :..:.:..| |.|..:|. |.|...|..|...| :|..:|:..::.:..|
plant   175 NLPLQENYQ-NFVMYVCNAYGSNQVPEACRILN-SSVETLSRSNSSVEKL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 38/128 (30%)
OSH1NP_195778.1 GILT 29..130 CDD:281251 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.