DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and GILT

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001154228.1 Gene:GILT / 826908 AraportID:AT4G12960 Length:243 Species:Arabidopsis thaliana


Alignment Length:254 Identity:62/254 - (24%)
Similarity:101/254 - (39%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLMSCLIATAYS-------AAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGK 67
            :...||:...::       :.||.:::|||||||...:||.:.:......:|..:.:|...|||.
plant    10 VFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIFDYDLYTITDLKLFPFGN 74

  Fly    68 SQFVTQGSEVTFTCHHGPNECYGNKVHACAI-----EHIQANSYQVEYTRESLTMDFINCLMKAG 127
            ::.   ...:|.||.||..||..|.:.|||:     :..:.:.|..:.::.|    ||.|:    
plant    75 AEL---SDNLTVTCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQKSQYS----FIRCV---- 128

  Fly   128 KNFPDNVYPGQRCASENHINNWEN----------IKTCANSTEGSVLLRKAGESTMRLKEPLTSV 182
                           |:....||:          |..|.|......|:......|..||.|...|
plant   129 ---------------ESDTKGWESCVKNSGREKAINDCYNGDLSRKLILGYATKTKNLKPPHEYV 178

  Fly   183 PTILFNEQFDKKVNDRAQV--NLVGTICQYVSAPQPRICNQHNGAST-PSLASVSAILS 238
            |.:..|   .|.::|..|.  :||.           :|||.:.|.:| |.:.:.||.:|
plant   179 PWVTLN---GKPLDDSVQSTDDLVA-----------QICNAYKGKTTLPKVCNSSASMS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 30/121 (25%)
GILTNP_001154228.1 GILT 33..141 CDD:281251 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.