DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and AT4G12900

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_193026.1 Gene:AT4G12900 / 826902 AraportID:AT4G12900 Length:231 Species:Arabidopsis thaliana


Alignment Length:231 Identity:56/231 - (24%)
Similarity:87/231 - (37%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLMSCLIATAYS--------AAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFG 66
            :..:||:...:|        :.||.:::|||||||....||...:......:|..:.:|..:|||
plant    14 VFFACLLLFTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLGKIFNTDLHTITDLKLIPFG 78

  Fly    67 KSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFP 131
            .:..   ..::|.||.||..||..|.:.||||.         .:..:.|...||.|:        
plant    79 NAHV---SDDLTVTCQHGEEECKLNALEACAIR---------TWPNQRLHYKFIRCV-------- 123

  Fly   132 DNVYPGQRCASENHINNWEN----------IKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTIL 186
                       |.:.|.||:          |..|.|......|:......|:.||.....||.:.
plant   124 -----------ETNTNAWESCVKKYGGEKAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMT 177

  Fly   187 FN-EQFDKKVNDRAQVNLVGTICQYV--SAPQPRIC 219
            .| |...:.:.|     .|..:|:..  .|..|::|
plant   178 LNGEPLYENIGD-----FVDLVCKAYKGKAALPKLC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 30/116 (26%)
AT4G12900NP_193026.1 GILT 38..137 CDD:367408 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.