DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and AT4G12890

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:223 Identity:63/223 - (28%)
Similarity:96/223 - (43%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLLMSCLIATAYS--------AAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPF 65
            ||.::||....||        :.||.|::|||||||....||.:.:......:|..:.:|..|||
plant    15 CLFLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKLVPF 79

  Fly    66 GKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTR--ESLTMDFINCLMKAGK 128
            |.:..   .:.:|.||.||..||..|.:.||.|..:.....|.::.|  |..|.::.:|:.|:|:
plant    80 GNAHI---SNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEKDTNEWESCVKKSGR 141

  Fly   129 NFPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDK 193
                          |..||:      |.|......|:....:.|..||.....||.:..|   .|
plant   142 --------------EKAIND------CYNGDLSQKLILGYAKLTSSLKPKHEYVPWVTLN---GK 183

  Fly   194 KVNDRAQVNLVGTICQ-YVSAPQPRICN 220
            .:.|... |||..:|: |.....|::|:
plant   184 PLYDNYH-NLVAQVCKAYKGKDLPKLCS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 34/118 (29%)
AT4G12890NP_567395.1 GILT 40..139 CDD:367408 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.