DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and AT4G12870

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_193023.2 Gene:AT4G12870 / 826899 AraportID:AT4G12870 Length:229 Species:Arabidopsis thaliana


Alignment Length:241 Identity:58/241 - (24%)
Similarity:94/241 - (39%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHKIAAVCLLMSCLIATAYS-------AAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVV 58
            :|...:...:..:|.:...:|       :.||.:::|||||||....||.:::......:|..:.
plant     2 VSPSFSTKLVFFACFVLFTFSHKLVTGESDKVELNLYYESLCPGCQSFIVDELVKVFDSDLDTIT 66

  Fly    59 ELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCL 123
            ::..||||   :....:.:|..|.||..||..|.:.||.|..:.....|.:         ||.|:
plant    67 DVKLVPFG---YAKVSNNLTVICQHGEEECKLNALEACVINTLPNPKSQYK---------FIRCV 119

  Fly   124 MKAGKNFPDNVYPGQRCASENHINNWEN-----------IKTCANSTEGSVLLRKAGESTMRLKE 177
                               ||:.:|||:           |..|.||.....|:....:.|..||.
plant   120 -------------------ENNTDNWESSCLKGYGNEKAINDCYNSDLSKKLILGYAKQTSSLKP 165

  Fly   178 PLTSVPTILFNEQ-FDKKVNDRAQVNLVGTICQYV--SAPQPRICN 220
            ....||.:..|.: ...|::|     |||.:|:..  ..|.|..|:
plant   166 KHEFVPWVTINSKPLYTKLDD-----LVGQVCKAYKGKTPLPIDCS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 28/116 (24%)
AT4G12870NP_193023.2 GILT 34..134 CDD:281251 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.