DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and Ifi30

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_075552.2 Gene:Ifi30 / 65972 MGIID:2137648 Length:248 Species:Mus musculus


Alignment Length:207 Identity:55/207 - (26%)
Similarity:91/207 - (43%) Gaps:40/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECY 89
            |.:|:||||||.....|:...::|... .:.:::.:|.||:|.:|.........|||.||..||.
Mouse    59 VRVSLYYESLCGACRYFLVRDLFPTWL-MVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECR 122

  Fly    90 GNKVHACAIEHIQANSYQVEYTRESLTMDFINCL-------MKAG---KNFPDNVYPGQRCASEN 144
            .|.|.||.::.::         :|:..:..: |:       .|.|   :.:...|.|        
Mouse   123 LNMVEACLLDKLE---------KEAAFLTIV-CMEEMDDMEKKLGPCLQVYAPEVSP-------- 169

  Fly   145 HINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGTICQ 209
                 |:|..||....|:.|:.:..:.|..|..|...||.:|.||   |.:.|.::  |:..:||
Mouse   170 -----ESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNE---KPLKDPSE--LLSIVCQ 224

  Fly   210 -YVSAPQPRICN 220
             |....:|.||:
Mouse   225 LYQGTEKPDICS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 31/126 (25%)
Ifi30NP_075552.2 GILT 61..163 CDD:281251 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - otm42622
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.