DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and CG41378

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001163836.1 Gene:CG41378 / 5740475 FlyBaseID:FBgn0085638 Length:228 Species:Drosophila melanogaster


Alignment Length:218 Identity:65/218 - (29%)
Similarity:110/218 - (50%) Gaps:32/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAVCLLMSCL------IATAY----SAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVE 59
            :|.|||.:..|      :.|:.    :..||.:::|||:|||||..|:|:|:.|..| ..:.::|
  Fly    16 VALVCLFIVVLWYYPVPVLTSQLHGGALMKVVVTVYYEALCPDSKYFLTKQLLPTFK-IAKSIME 79

  Fly    60 LTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLM 124
            :...|:||::......::||.|.|||.||..|..||||.|.|:         ...|.::...|::
  Fly    80 VKLAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIE---------DPLLRLEVATCMI 135

  Fly   125 KAGKNFPDNVYPGQ---RCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTIL 186
            .      ||..|.:   :|.|:.:.:: ..|:.|..|..|..||:..||||..|:.|:|.:|||.
  Fly   136 M------DNHSPQEAMNKCTSQINFDD-SVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTIT 193

  Fly   187 FNEQFDKKVNDRAQVNLVGTICQ 209
            .:....::  :....:|:..:|:
  Fly   194 IDGSQGRQ--ESILKDLLSEVCK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 38/119 (32%)
CG41378NP_001163836.1 GILT 47..152 CDD:281251 39/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124553at33392
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - otm42622
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.