DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and si:dkey-197i20.6

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_693944.2 Gene:si:dkey-197i20.6 / 565583 ZFINID:ZDB-GENE-131127-557 Length:256 Species:Danio rerio


Alignment Length:198 Identity:60/198 - (30%)
Similarity:92/198 - (46%) Gaps:23/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECY 89
            |.||:||||||.....|:|||::|... .|:|::::..||||.::.|.:  |.:|:|.||..|||
Zfish    67 VEISLYYESLCSGCRAFLTEQLFPTWT-LLKDIMKVNLVPFGNAKEVPE--ENSFSCQHGEPECY 128

  Fly    90 GNKVHACAIEHIQANSYQVEYTRES---LTMDFINCLMKAGKNFPDNVYPGQRCASENHINNWEN 151
            .|.|.||.:......::.|.:..||   :|.....||         .:|.        ....||.
Zfish   129 ANMVEACVLYEATHAAFPVIHCMESSADVTQSAKPCL---------QLYA--------PFIKWET 176

  Fly   152 IKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGTICQYVSAPQP 216
            |::|.....|..|:.:....|..||...|.||.|..|.::..::.|:|...|...:|......:|
Zfish   177 IESCTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYKGIKP 241

  Fly   217 RIC 219
            .:|
Zfish   242 PVC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 39/119 (33%)
si:dkey-197i20.6XP_693944.2 SapA <33..54 CDD:295328
GILT 68..168 CDD:281251 38/111 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12298
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4959
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - otm25897
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.