DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and ifi30

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 / 549950 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis


Alignment Length:208 Identity:56/208 - (26%)
Similarity:89/208 - (42%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGP 85
            |...:.|.::|||||.....|:..|::|:.. .|.:::.:|.||:|.:|......:..|.|.|||
 Frog    55 SEPAIQIDLFYESLCGGCRGFLVRQLFPSWL-MLAEIINVTLVPYGNAQETNITGKWVFDCQHGP 118

  Fly    86 NECYGNKVHACAIEHIQANSYQ---VEYTRES---LTMDFINCLMKAGKNFPDNVYPGQRCASEN 144
            .||.||.:.||.| ||..:.|:   :.:..||   :|....:||.......|             
 Frog   119 EECLGNMMEACLI-HILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPELP------------- 169

  Fly   145 HINNWENIKT---CANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGT 206
                   :||   |.|...|:.|:.:..:.|..|..|...||.|:.:......:..:||.:|...
 Frog   170 -------LKTVLECVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNL 227

  Fly   207 ICQYVSAPQPRIC 219
            :|.....|:|..|
 Frog   228 VCDTYKGPKPEPC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 36/122 (30%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 33/102 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm9398
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.