DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and GILT2

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster


Alignment Length:221 Identity:57/221 - (25%)
Similarity:101/221 - (45%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCLLMSCL-IAT-----AYSAAKVPISIYYESLCPDSAKFITEQVYPA-VKGELRDVVELTFVPF 65
            ||||:..: :||     ...|.::.|::|||:|||...:|:|.|:.|: |:.:.....:||.||:
  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPY 71

  Fly    66 GKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNF 130
            |.::....|:   ..|.||..||..|..|||.:||...          :.::..|.|:|:..|| 
  Fly    72 GNARTNDDGN---VECQHGVMECELNAWHACILEHHDI----------AQSLKLIACMMRGKKN- 122

  Fly   131 PDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTIL--------- 186
                 ..::||....|:..: :|.|..:.:.:.:|||.|:.|.::.  ...||.:.         
  Fly   123 -----RLEKCADHYQIDVGD-VKNCKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADL 179

  Fly   187 ---------------FNEQFDKKVND 197
                           :.|:|:|::|:
  Fly   180 SANLTDHFDAIFCAKYKEKFNKQLNN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 36/117 (31%)
GILT2NP_651166.1 GILT 32..130 CDD:308710 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D159048at6656
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.