DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and GILT3

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster


Alignment Length:218 Identity:57/218 - (26%)
Similarity:98/218 - (44%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AKVPISIYYESLCPDSAKFITEQVYPAVK-GELRDVVELTFVPFGKSQFV--TQGSEVTFTCHHG 84
            :::.::|:||:|||||..||..::|.|:: .:...|.:|...||||:.|.  |...|....|.||
  Fly    29 SRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAGFYNNTSTGESQVFCQHG 93

  Fly    85 PNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPGQRCASENHINNW 149
            .:||..|.:|||.||.:....          ..:.|.|::   :::.:.:.|   |:....: :.
  Fly    94 VDECELNALHACIIETLDIRK----------AFNLIYCML---RSYSNELGP---CSRSMGV-DV 141

  Fly   150 ENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGTICQYVSAP 214
            ...:.|..|...:.:|...|:.|::|  .::.||||:|...||.......:.|.           
  Fly   142 SKARECKASRTTAEILAPYGKETLKL--GISFVPTIVFENDFDPYDQRSIRNNF----------- 193

  Fly   215 QPRICNQHNGASTPSLASVSAIL 237
            :...|.|:.......|.:.||||
  Fly   194 ERHFCRQYLKKFNIKLPTCSAIL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 36/119 (30%)
GILT3NP_651165.1 GILT 33..127 CDD:308710 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D159048at6656
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.