DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and CG9427

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster


Alignment Length:216 Identity:67/216 - (31%)
Similarity:109/216 - (50%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIAAVCLLMSCLIATAYS-----------AAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDV 57
            |:|:...|:..:::..::           :.|:.|::.||||||||..|: .|:.| |..|..|.
  Fly     3 KLASTASLLLLVLSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNFM-HQLGP-VYEEFGDY 65

  Fly    58 VELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINC 122
            :::..|||||||....|:  .|.|.|||.||.||::.:|.|......:.||:         |:.|
  Fly    66 IDILLVPFGKSQSERNGA--IFHCQHGPAECKGNRLQSCVINSTANQAAQVK---------FVVC 119

  Fly   123 LMKAGKNFPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILF 187
            .|.|    ||.....| ||:|..:  ..::..|.:|..|:.|..:| |...:...| :.:|||::
  Fly   120 QMLA----PDYSRIDQ-CANEAGL--LTDVVHCLSSETGTKLQLQA-ELVTKQYSP-SFIPTIVY 175

  Fly   188 NEQFDKKVNDRAQVNLVGTIC 208
            |..||:::.|.:..:..||:|
  Fly   176 NGVFDQQLQDHSLRDFRGTVC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 45/116 (39%)
CG9427NP_649919.1 GILT 36..136 CDD:281251 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124553at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.