DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and F37H8.5

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_496397.1 Gene:F37H8.5 / 3564874 WormBaseID:WBGene00009514 Length:277 Species:Caenorhabditis elegans


Alignment Length:226 Identity:57/226 - (25%)
Similarity:91/226 - (40%) Gaps:54/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHKIAAVCLLMSCLIATAYSAA--------------------------------KVPISIYYES 33
            |.:::.|..||:..:.||...||                                |:.|::..|:
 Worm    20 MLYRLVAAILLLGAVQATINCAAIPTSLWCSNKDLEAKCGFASFCDKHRAATHNQKINITVLIEA 84

  Fly    34 LCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAI 98
            ||||...|:|:|:||.|.....:.|.:..||||.::.:..|   |..|.||..||..||...|.|
 Worm    85 LCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLEDG---TIKCQHGEEECSINKFEGCFI 146

  Fly    99 EHIQANSYQVEYTRESLTMDFINCL---MKAGKNFPDNVYPGQRCASENHINN--WENIKTCANS 158
            :.:|..|          .:..::|:   ::....|.|.|   |:|..:..|..  ....::|..|
 Worm   147 DSMQDQS----------PLPTLSCIEESLQKKVEFADAV---QQCFEKLQIGGDIQRLTQSCLVS 198

  Fly   159 TEGSVLLRKAGESTMRL-KEPLTSVPTILFN 188
            ..|:.|..||..:|..: .|....||.::.|
 Worm   199 KLGADLQNKAAAATANVWPEQHKFVPWVIIN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 36/119 (30%)
F37H8.5NP_496397.1 GILT 77..182 CDD:281251 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.