DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and Ifi30

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001025197.1 Gene:Ifi30 / 290644 RGDID:1310758 Length:248 Species:Rattus norvegicus


Alignment Length:229 Identity:63/229 - (27%)
Similarity:101/229 - (44%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AAVCLLMS-CLIA--TAYSAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGK 67
            ||.|.... ||..  ...||..|.:|:||||||.....|:...::|... .:.:::.:|.||:|.
  Rat    37 AATCKAHDLCLFGPRRLLSAPPVNVSLYYESLCGACRYFLVRNLFPTWL-MVMEIMNITLVPYGN 100

  Fly    68 SQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCL-------MK 125
            :|.........|||.||..||..|||.||.::.::         :|:..:..: |:       .|
  Rat   101 AQERNVSGTWEFTCQHGELECKLNKVEACLLDKLE---------KEAAFLTIV-CMEEMEDMEKK 155

  Fly   126 AG---KNFPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILF 187
            .|   :.:...|.|             |:|..||....|:.|:.:..:.|..|:.|...||.:|.
  Rat   156 LGPCLQLYVPEVSP-------------ESIMECATGKRGTELMHENAQLTDALQPPHEYVPWVLV 207

  Fly   188 NEQFDKKVNDRAQVNLVGTICQ-YVSAPQPRICN 220
            ||   |.:.|.:|  |:.::|: |....:|.||:
  Rat   208 NE---KPLTDPSQ--LLSSVCELYQGTEKPDICS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 32/126 (25%)
Ifi30NP_001025197.1 GILT 60..163 CDD:281251 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - otm44688
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.