DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and ZK669.3

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_495669.1 Gene:ZK669.3 / 191388 WormBaseID:WBGene00014053 Length:218 Species:Caenorhabditis elegans


Alignment Length:229 Identity:54/229 - (23%)
Similarity:88/229 - (38%) Gaps:42/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCLLMSCLIATAYSAAK--------VPISIYYESLCPDSAKFITEQVYPAVK-----GELRDVVE 59
            :||:   |..|..|.||        |.|..:.|..|.|::.::.....|..:     |.    :.
 Worm     9 ICLI---LFITKISYAKDKGANGDMVNIVAFGEGRCSDTSYWMKWHWLPMWRMLGSTGR----IN 66

  Fly    60 LTFVPFG-KSQFVTQGS--EVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFIN 121
            ..:.|:| |:..|...|  :|...||||..||..|::.||.||.:.  ::: :|      |:.:.
 Worm    67 FDYHPYGIKTTCVDSESADDVVCDCHHGNRECLLNQLQACVIEALP--NFE-DY------MEVVT 122

  Fly   122 CLMKAGKNFPDNVYPGQRCASENHIN-NWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTI 185
            |:.  ||   .|:........|.... :...:..||.|..|..|.........::...:...|.|
 Worm   123 CIQ--GK---QNISMAAEVCFEGPTKLDRTKMMECAESRHGRKLFSDQENIVAQMAPEMDWAPWI 182

  Fly   186 LFNEQFDKKVNDRAQVNLVGTICQYVSAPQPRIC 219
            |.|....|:    |:.:|...:|.....|:|..|
 Worm   183 LINGTRYKE----AEEDLWQFLCDRFIDPRPIHC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 29/124 (23%)
ZK669.3NP_495669.1 GILT 32..139 CDD:281251 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm4785
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.