DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and ZK669.2

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001364576.1 Gene:ZK669.2 / 191387 WormBaseID:WBGene00014052 Length:234 Species:Caenorhabditis elegans


Alignment Length:225 Identity:60/225 - (26%)
Similarity:94/225 - (41%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMSCLIATAYSAAKVP---ISIYYESLCPDSAKFITEQVYPA-VKGELRDVVELTFVPFGKSQFV 71
            :...::|...|.||.|   |..:.||||||:.::....:.|. ...:....:.:|:.|||.:. .
 Worm    27 IYKAMMADQASRAKTPPINIEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLAS-C 90

  Fly    72 TQGSE--VTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKN-FPDN 133
            .:.:|  :...|.|||.||..|.:.||.|..:|.         ..|.:..:||:.  ||| |.. 
 Worm    91 RRSAETGIRCNCQHGPAECQLNMLQACVISTLQV---------PQLYLPIVNCMQ--GKNKFSS- 143

  Fly   134 VYPGQRCASENHINNW-------EN-IKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQ 190
                   |.::.|.|:       || :..||.|..|:.|:.:.|.....:...|..||.||.|.:
 Worm   144 -------AVDDCIVNFRPRPDLDENFMARCAQSQLGAKLMMQHGYRQKEVASELDWVPWILINGR 201

  Fly   191 FDKKVNDRAQVNLVGTI-CQYVSAPQPRIC 219
                 ..:|..|.:.|| ||:....:...|
 Worm   202 -----RSQAAENQLKTIVCQFSETSKQEYC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 33/123 (27%)
ZK669.2NP_001364576.1 GILT 45..149 CDD:397369 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm4785
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.