DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and Y18D10A.2

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_493240.2 Gene:Y18D10A.2 / 189471 WormBaseID:WBGene00012475 Length:212 Species:Caenorhabditis elegans


Alignment Length:208 Identity:58/208 - (27%)
Similarity:84/208 - (40%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TAYSAAKVPISIYYESLCPDSAKFITEQV---YPAVKGELRDVVELTF--VPFGKSQFVTQGSEV 77
            :|.:.|...:.::..|.|||::|||..|:   |...||.|.|.::|.|  ||.|..|  ..|..|
 Worm    30 SAVATASDLVEVFGISRCPDTSKFIHNQLVPFYQNYKGNLSDGLKLDFHAVPTGGHQ--VDGKYV 92

  Fly    78 TFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVY-PGQRCA 141
            . .|.||..||..||:..|:.:||:.                 :.|:.||.......| .|.:|.
 Worm    93 N-RCLHGALECALNKLQMCSKKHIKQ-----------------DWLVTAGCIQGKTAYSAGLKCL 139

  Fly   142 SENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVGT 206
            .:.  ...:.::.||.|.||..||.........:......:|.|    |.:.:.|..|:..|...
 Worm   140 PDT--EEGKIVQNCAESEEGEYLLNDENSYRYNVAPHSAWLPWI----QVNGERNRNAEFKLKDV 198

  Fly   207 ICQYVSAPQPRIC 219
            |||..|.....||
 Worm   199 ICQLESMKGNEIC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 37/122 (30%)
Y18D10A.2NP_493240.2 GILT 39..142 CDD:281251 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.