DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and W04A4.3

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_493398.1 Gene:W04A4.3 / 189179 WormBaseID:WBGene00012232 Length:149 Species:Caenorhabditis elegans


Alignment Length:107 Identity:26/107 - (24%)
Similarity:41/107 - (38%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CPDSAKFITEQVYP------AVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNECYGNKV 93
            |..:.|:...|:.|      |.||...  :::.:.|....|....|:.|. ||.:|..||..||:
 Worm    44 CALTTKWFRTQLAPFLGNLTAKKGPKN--LKMVYHPLSIGQKKGNGTAVA-TCENGWLECQLNKL 105

  Fly    94 HACAIEHIQANSYQVEYTRESLTMDF-----INCLMKAGKNF 130
            ..|.          .:|:|.  ..||     :.|:.  ||.:
 Worm   106 QCCT----------KKYSRN--VTDFEILAVLECIQ--GKQW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 26/107 (24%)
W04A4.3NP_493398.1 GILT 36..142 CDD:281251 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.