DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and C02D5.2

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001040839.1 Gene:C02D5.2 / 176203 WormBaseID:WBGene00015336 Length:323 Species:Caenorhabditis elegans


Alignment Length:213 Identity:54/213 - (25%)
Similarity:92/213 - (43%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPISIYYESLCPDSAKFITEQVYPA--VKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPNE 87
            |.:.:|.|:.|||:::|..:|:..|  :.|.| :.:||..:||||::...:|::....|.|||.|
 Worm   139 VKLDVYMEAQCPDTSRFFRQQLKKAWDILGRL-NRIELNVIPFGKARCTEKGNDFECQCQHGPTE 202

  Fly    88 CYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNVYPG-------------QR 139
            |..|::..|.|:..                           .||....||             .:
 Worm   203 CQINQLMNCVIDRF---------------------------GFPHRYLPGVLCMQGKYSLDEAMK 240

  Fly   140 CASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLV 204
            |.:||:.:.:|.::.||:.|.|..||..:|:.|..|...:..:|.|:.|    ...|..|..:|.
 Worm   241 CVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVIN----GSRNSDALYDLT 301

  Fly   205 GTICQYVSAPQPRICNQH 222
            ..:|:.:. |.|..|..:
 Worm   302 QNVCEAMQ-PMPSACKDY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 31/131 (24%)
C02D5.2NP_001040839.1 GILT 140..246 CDD:281251 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm4785
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.