DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and pqn-48

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_494711.1 Gene:pqn-48 / 173743 WormBaseID:WBGene00004135 Length:319 Species:Caenorhabditis elegans


Alignment Length:175 Identity:50/175 - (28%)
Similarity:85/175 - (48%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VPISIYYESLCPDSAKFITEQ---VYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGPN 86
            :.|::.||:|||...|||..|   |:...:|:|  ::||  ||:|.|:.:..||   |:|:||..
 Worm   141 IKITLIYEALCPYCQKFIANQLGSVFNQFQGQL--ILEL--VPWGNSRIMRDGS---FSCNHGQK 198

  Fly    87 ECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNV------YPGQRCASENH 145
            ||..|::.:|.|:.::...          .:.||.|       |..|:      :..|.|::...
 Worm   199 ECDANRLQSCVIDILKVKG----------ALPFIVC-------FERNIQHYGVEHAMQTCSAFIR 246

  Fly   146 INNWENIKTCANSTEGSVLLRKAGESTMRLK-EPLTSVPTILFNE 189
             :.:..|:.|.:...|..|.|:|.:.||..: .|:..||.:|.|:
 Worm   247 -SQYRQIRQCYDGPRGVQLQREAAQKTMSTRPNPILEVPYLLIND 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 37/125 (30%)
pqn-48NP_494711.1 GILT 142..242 CDD:281251 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.