DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT1 and IFI30

DIOPT Version :9

Sequence 1:NP_650287.3 Gene:GILT1 / 41650 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_006323.2 Gene:IFI30 / 10437 HGNCID:5398 Length:250 Species:Homo sapiens


Alignment Length:223 Identity:58/223 - (26%)
Similarity:93/223 - (41%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQGSEVTFTCHHGP 85
            :|..|.:::|||:||.....|:..:::|... .:.:::.:|.||:|.:|.........|.|.||.
Human    58 NAPLVNVTLYYEALCGGCRAFLIRELFPTWL-LVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGE 121

  Fly    86 NECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPD---------NVY-PGQRC 140
            .||..|||.||.::.:..          .|....|.|:    :.|.|         .:| ||.  
Human   122 EECKFNKVEACVLDELDM----------ELAFLTIVCM----EEFEDMERSLPLCLQLYAPGL-- 170

  Fly   141 ASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKKVNDRAQVNLVG 205
                   :.:.|..||....|..|:....:.|..|:.|...||.:..|   .|.:.|:.|  |:.
Human   171 -------SPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVN---GKPLEDQTQ--LLT 223

  Fly   206 TICQYVSAPQPRICNQHNGASTPSLASV 233
            .:||.....:|.:|    .:||.||.||
Human   224 LVCQLYQGKKPDVC----PSSTSSLRSV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT1NP_650287.3 GILT 26..143 CDD:308710 31/126 (25%)
IFI30NP_006323.2 GILT 63..164 CDD:308710 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - otm40551
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.